Recombinant Human PRPF19, His-tagged
Cat.No. : | PRPF19-30592TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 235-504 of Human PRP19 with an N terminal His tag. Predicted mwt: 31 kDa; |
- Specification
- Gene Information
- Related Products
Description : | PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 118 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHP SQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGL SLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSG CSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPG HSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFK TLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWT EILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL |
Gene Name : | PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol : | PRPF19 |
Synonyms : | PRPF19; PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae); PRP19, PRP19/PSO4 homolog (S. cerevisiae); pre-mRNA-processing factor 19; hPSO4; NMP200; nuclear matrix protein NMP200 related to splicing factor PRP19; PSO4; UBOX4; |
Gene ID : | 27339 |
mRNA Refseq : | NM_014502 |
Protein Refseq : | NP_055317 |
MIM : | 608330 |
Uniprot ID : | Q9UMS4 |
Chromosome Location : | 11q12.2 |
Pathway : | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; Spliceosome, Prp19/CDC5L complex, organism-specific biosystem; Ubiquitin mediated proteolysis, organism-specific biosystem; |
Function : | DNA binding; identical protein binding; protein binding; ubiquitin-protein ligase activity; ubiquitin-ubiquitin ligase activity; |
Products Types
◆ Recombinant Protein | ||
Prpf19-5145M | Recombinant Mouse Prpf19 Protein, Myc/DDK-tagged | +Inquiry |
PRPF19-4377R | Recombinant Rat PRPF19 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRPF19-3441R | Recombinant Rhesus Macaque PRPF19 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRPF19-4718R | Recombinant Rat PRPF19 Protein | +Inquiry |
PRPF19-3384C | Recombinant Chicken PRPF19 | +Inquiry |
◆ Lysates | ||
PRPF19-2828HCL | Recombinant Human PRPF19 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket