"PRPF19" Related Products

Expand
Expand

Recombinant Human PRPF19, His-tagged

Cat.No.: PRPF19-30592TH
Product Overview: Recombinant fragment, corresponding to amino acids 235-504 of Human PRP19 with an N terminal His tag. Predicted mwt: 31 kDa;
Description: PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 118 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHP SQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGL SLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSG CSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPG HSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFK TLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWT EILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL
Gene Name: PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol: PRPF19
Synonyms: PRPF19; PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae); PRP19, PRP19/PSO4 homolog (S. cerevisiae); pre-mRNA-processing factor 19; hPSO4; NMP200; nuclear matrix protein NMP200 related to splicing factor PRP19; PSO4; UBOX4;
Gene ID: 27339
mRNA Refseq: NM_014502
Protein Refseq: NP_055317
MIM: 608330
Uniprot ID: Q9UMS4
Chromosome Location: 11q12.2
Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; Spliceosome, Prp19/CDC5L complex, organism-specific biosystem; Ubiquitin mediated proteolysis, organism-specific biosystem;
Function: DNA binding; identical protein binding; protein binding; ubiquitin-protein ligase activity; ubiquitin-ubiquitin ligase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.