"PRRG1" Related Products

Recombinant Human PRRG1

Cat.No.: PRRG1-30706TH
Product Overview: Recombinant full length Human PRRG1 with a N terminal proprietary tag; Predicted MWt 51.90 kDa.
Description: This gene encodes a vitamin K-dependent, gamma-carboxyglutamic acid (Gla)-containing, single-pass transmembrane protein. This protein contains a Gla domain at the N-terminus, preceded by a propeptide sequence required for post-translational gamma-carboxylation of specific glutamic acid residues by a vitamin K-dependent gamma-carboxylase. The C-terminus is proline-rich containing PPXY and PXXP motifs found in a variety of signaling and cytoskeletal proteins. This gene is highly expressed in the spinal cord. Several alternatively spliced transcript variants have been found for this gene.
Protein length: 218 amino acids
Molecular Weight: 51.900kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in the spinal cord.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEE FCTFEEAREAFENNEKTKEFWSTYTKAQQGESNRGSDWFQ FYLTFPLIFGLFIILLVIFLIWRCFLRNKTRRQTVTEGHI PFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVS TRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIV NSNSASAIPMVPVVTTIK
Sequence Similarities: Contains 1 Gla (gamma-carboxy-glutamate) domain.
Gene Name: PRRG1 proline rich Gla (G-carboxyglutamic acid) 1 [ Homo sapiens ]
Official Symbol: PRRG1
Synonyms: PRRG1; proline rich Gla (G-carboxyglutamic acid) 1; proline rich Gla (G carboxyglutamic acid) polypeptide 1; transmembrane gamma-carboxyglutamic acid protein 1; PRGP1;
Gene ID: 5638
mRNA Refseq: NM_000950
Protein Refseq: NP_000941
MIM: 604428
Uniprot ID: O14668
Chromosome Location: Xp21.1
Function: calcium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.