Recombinant Human PRRG1
Cat.No. : | PRRG1-30706TH |
Product Overview : | Recombinant full length Human PRRG1 with a N terminal proprietary tag; Predicted MWt 51.90 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 218 amino acids |
Description : | This gene encodes a vitamin K-dependent, gamma-carboxyglutamic acid (Gla)-containing, single-pass transmembrane protein. This protein contains a Gla domain at the N-terminus, preceded by a propeptide sequence required for post-translational gamma-carboxylation of specific glutamic acid residues by a vitamin K-dependent gamma-carboxylase. The C-terminus is proline-rich containing PPXY and PXXP motifs found in a variety of signaling and cytoskeletal proteins. This gene is highly expressed in the spinal cord. Several alternatively spliced transcript variants have been found for this gene. |
Molecular Weight : | 51.900kDa inclusive of tags |
Tissue specificity : | Highly expressed in the spinal cord. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEE FCTFEEAREAFENNEKTKEFWSTYTKAQQGESNRGSDWFQ FYLTFPLIFGLFIILLVIFLIWRCFLRNKTRRQTVTEGHI PFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVS TRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIV NSNSASAIPMVPVVTTIK |
Sequence Similarities : | Contains 1 Gla (gamma-carboxy-glutamate) domain. |
Gene Name | PRRG1 proline rich Gla (G-carboxyglutamic acid) 1 [ Homo sapiens ] |
Official Symbol | PRRG1 |
Synonyms | PRRG1; proline rich Gla (G-carboxyglutamic acid) 1; proline rich Gla (G carboxyglutamic acid) polypeptide 1; transmembrane gamma-carboxyglutamic acid protein 1; PRGP1; |
Gene ID | 5638 |
mRNA Refseq | NM_000950 |
Protein Refseq | NP_000941 |
MIM | 604428 |
Uniprot ID | O14668 |
Chromosome Location | Xp21.1 |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
RFL33293HF | Recombinant Full Length Human Transmembrane Gamma-Carboxyglutamic Acid Protein 1(Prrg1) Protein, His-Tagged | +Inquiry |
PRRG1-3633R | Recombinant Rhesus monkey PRRG1 Protein, His-tagged | +Inquiry |
PRRG1-5104C | Recombinant Chicken PRRG1 | +Inquiry |
PRRG1-3451R | Recombinant Rhesus Macaque PRRG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRRG1-407HF | Recombinant Full Length Human PRRG1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRRG1-2811HCL | Recombinant Human PRRG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRRG1 Products
Required fields are marked with *
My Review for All PRRG1 Products
Required fields are marked with *
0
Inquiry Basket