"PSG9" Related Products

Recombinant Human PSG9

Cat.No.: PSG9-30346TH
Product Overview: Recombinant full length mature Human PSG9 protein with an N terminal proprietary tag; Predicted MW 69.23 kDa.
Description: The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390).
Protein length: 392 amino acids
Molecular Weight: 69.230kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKGEMTD LYHYIISYIVDGKIIIYGPAYSGRETVYSNASLLIQNVTR KDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYISSS NLNPREAMEAVRLICDPETLDASYLWWMNGQSLPVTHRLQ LSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLN LLPKLPIPYITINNLNPRENKDVLAFTCEPKSENYTYIWW LNGQSLPVSPGVKRPIENRILILPSVTRNETGPYQCEIQD RYGGLRSNPVILNVLYGPDLPRIYPSFTYYRSGENLDLSC FTESNPPAEYFWTINGKFQQSGQKLFIPQITRNHSGLYAC SVHNSATGKEISKSMTVKVSGPCHGDLTESQS
Sequence Similarities: Belongs to the immunoglobulin superfamily. CEA family.Contains 3 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name: PSG9 pregnancy specific beta-1-glycoprotein 9 [ Homo sapiens ]
Official Symbol: PSG9
Synonyms: PSG9; pregnancy specific beta-1-glycoprotein 9; PSG11; pregnancy-specific beta-1-glycoprotein 9; PSGII;
Gene ID: 5678
mRNA Refseq: NM_002784
Protein Refseq: NP_002775
MIM: 176398
Uniprot ID: Q00887
Chromosome Location: 19q13.2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.