Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human PSMC1, His-tagged

Cat.No. : PSMC1-30430TH
Product Overview : Recombinant fragment, corresponding to amino acids 225-440 of Human Proteasome 19S S4 with N terminal His tag; Predicted MWt 25 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway.An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit and a 20S core alpha subunit interact specifically with the hepatitis B virus X protein, a protein critical to viral replication. This subunit also interacts with the adenovirus E1A protein and this interaction alters the activity of the proteasome. Finally, this subunit interacts with ataxin-7, suggesting a role for the proteasome in the development of spinocerebellar ataxia type 7, a progressive neurodegenerative disorder.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 77 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGP KLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGE REIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPA LIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDV TLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNED FKKSKENVLYKKQEGTPEGLYL
Gene Name : PSMC1 proteasome (prosome, macropain) 26S subunit, ATPase, 1 [ Homo sapiens ]
Official Symbol : PSMC1
Synonyms : PSMC1; proteasome (prosome, macropain) 26S subunit, ATPase, 1; 26S protease regulatory subunit 4; p56; S4;
Gene ID : 5700
mRNA Refseq : NM_002802
Protein Refseq : NP_002793
MIM : 602706
Uniprot ID : P62191
Chromosome Location : 14q32.11
Pathway : APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function : ATP binding; ATPase activity; hydrolase activity; nucleotide binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All PSMC1 Products

Required fields are marked with *

My Review for All PSMC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends