Recombinant Human PSME3, His-tagged

• Cat.No.: PSME3-30434TH
• Product Overview: Recombinant full length Human PSME3 with an N terminal His tag; 274 amino acids with a predicted MWt of 31.7kDa including the tag.

Specification

• Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Two transcript variants encoding different isoforms have been identified.
• Protein length: 254 amino acids
• Conjugation: HIS
• Molecular Weight: 31.700kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 40% Glycerol, 1.17% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASLLKVDQEVKLKVDSFRE RITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHS DMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTK VFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWV QLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQIS RYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLI ISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
• Sequence Similarities: Belongs to the PA28 family.

Gene Information

• Gene Name: PSME3 proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) [ Homo sapiens ]
• Official Symbol: PSME3
• Synonyms: PSME3; proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki); proteasome activator complex subunit 3; Ki; PA28 gamma; PA28G; REG GAMMA
• Gene ID: 10197
• mRNA Refseq: NM_005789
• Protein Refseq: NP_005780
• MIM: 605129
• Uniprot ID: P61289
• Chromosome Location: 17q12-q21
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem
• Function: MDM2 binding; endopeptidase activator activity; p53 binding; protein binding