"PTGIR" Related Products

Expand
Expand

Recombinant Human PTGIR

Cat.No.: PTGIR-31205TH
Product Overview: Recombinant fragment of Human Prostaglandin I2 Receptor (aa 296-386) with N-terminal proprietary tag, 35.64 kDa.
Description: The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor.
Protein length: 91 amino acids
Molecular Weight: 35.640kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC
Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
Gene Name: PTGIR prostaglandin I2 (prostacyclin) receptor (IP) [ Homo sapiens ]
Official Symbol: PTGIR
Synonyms: PTGIR; prostaglandin I2 (prostacyclin) receptor (IP); prostacyclin receptor; IP;
Gene ID: 5739
mRNA Refseq: NM_000960
Protein Refseq: NP_000951
MIM: 600022
Uniprot ID: P43119
Chromosome Location: 19q13.3
Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Eicosanoid ligand-binding receptors, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function: G-protein coupled receptor activity; guanyl-nucleotide exchange factor activity; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.