Recombinant Human PTGIR

Cat.No. : PTGIR-31205TH
Product Overview : Recombinant fragment of Human Prostaglandin I2 Receptor (aa 296-386) with N-terminal proprietary tag, 35.64 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 91 amino acids
Description : The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor.
Molecular Weight : 35.640kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name PTGIR prostaglandin I2 (prostacyclin) receptor (IP) [ Homo sapiens ]
Official Symbol PTGIR
Synonyms PTGIR; prostaglandin I2 (prostacyclin) receptor (IP); prostacyclin receptor; IP;
Gene ID 5739
mRNA Refseq NM_000960
Protein Refseq NP_000951
MIM 600022
Uniprot ID P43119
Chromosome Location 19q13.3
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Eicosanoid ligand-binding receptors, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function G-protein coupled receptor activity; guanyl-nucleotide exchange factor activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTGIR Products

Required fields are marked with *

My Review for All PTGIR Products

Required fields are marked with *

0
cart-icon
0
compare icon