Recombinant Human PTGIR
Cat.No. : | PTGIR-31205TH |
Product Overview : | Recombinant fragment of Human Prostaglandin I2 Receptor (aa 296-386) with N-terminal proprietary tag, 35.64 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 91 amino acids |
Description : | The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor. |
Molecular Weight : | 35.640kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name | PTGIR prostaglandin I2 (prostacyclin) receptor (IP) [ Homo sapiens ] |
Official Symbol | PTGIR |
Synonyms | PTGIR; prostaglandin I2 (prostacyclin) receptor (IP); prostacyclin receptor; IP; |
Gene ID | 5739 |
mRNA Refseq | NM_000960 |
Protein Refseq | NP_000951 |
MIM | 600022 |
Uniprot ID | P43119 |
Chromosome Location | 19q13.3 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Eicosanoid ligand-binding receptors, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; |
Function | G-protein coupled receptor activity; guanyl-nucleotide exchange factor activity; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
PTGIR-31205TH | Recombinant Human PTGIR | +Inquiry |
RFL12776HF | Recombinant Full Length Human Prostacyclin Receptor(Ptgir) Protein, His-Tagged | +Inquiry |
PTGIR-4812R | Recombinant Rat PTGIR Protein | +Inquiry |
PTGIR-13646M | Recombinant Mouse PTGIR Protein | +Inquiry |
RFL10826RF | Recombinant Full Length Rat Prostacyclin Receptor(Ptgir) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGIR-2710HCL | Recombinant Human PTGIR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTGIR Products
Required fields are marked with *
My Review for All PTGIR Products
Required fields are marked with *
0
Inquiry Basket