Recombinant Human PTPMT1, His-tagged
Cat.No. : | PTPMT1-31117TH |
Product Overview : | Recombinant full length Human PTPMT1 with N terminal His tag; 199 amino acids with tag, Predicted MWt 22.6 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This protein phosphatase specifically mediates the dephosphorylation of mitochondrial proteins and consequently plays a central role in ATP production. |
Protein length : | 174 amino acids |
Conjugation : | HIS |
Molecular Weight : | 22.600kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMKVPGRAHRDWYHRID PTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCN SSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQ SLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAI AKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT |
Sequence Similarities : | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain. |
Gene Name : | PTPMT1 protein tyrosine phosphatase, mitochondrial 1 [ Homo sapiens ] |
Official Symbol : | PTPMT1 |
Synonyms : | PTPMT1; protein tyrosine phosphatase, mitochondrial 1; protein-tyrosine phosphatase mitochondrial 1; DUSP23; MOSP; PLIP; |
Gene ID : | 114971 |
mRNA Refseq : | NM_001143984 |
Protein Refseq : | NP_001137456 |
MIM : | 609538 |
Uniprot ID : | Q8WUK0 |
Chromosome Location : | 11p11.2 |
Pathway : | 3-phosphoinositide degradation, conserved biosystem; |
Function : | hydrolase activity; phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity; |
Products Types
◆ Recombinant Protein | ||
PTPMT1-2547H | Active Recombinant Human PTPMT1 protein(Lys28-Thr201), His-tagged | +Inquiry |
PTPMT1-3520R | Recombinant Rhesus Macaque PTPMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPMT1-5044Z | Recombinant Zebrafish PTPMT1 | +Inquiry |
PTPMT1-4636H | Recombinant Human PTPMT1 protein, His-SUMO-tagged | +Inquiry |
PTPMT1-3703R | Recombinant Rhesus monkey PTPMT1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
PTPMT1-1436HCL | Recombinant Human PTPMT1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket