Recombinant Human PTPMT1, His-tagged
| Cat.No. : | PTPMT1-31117TH |
| Product Overview : | Recombinant full length Human PTPMT1 with N terminal His tag; 199 amino acids with tag, Predicted MWt 22.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 174 amino acids |
| Description : | This protein phosphatase specifically mediates the dephosphorylation of mitochondrial proteins and consequently plays a central role in ATP production. |
| Conjugation : | HIS |
| Molecular Weight : | 22.600kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMKVPGRAHRDWYHRID PTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCN SSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQ SLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAI AKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT |
| Sequence Similarities : | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain. |
| Gene Name | PTPMT1 protein tyrosine phosphatase, mitochondrial 1 [ Homo sapiens ] |
| Official Symbol | PTPMT1 |
| Synonyms | PTPMT1; protein tyrosine phosphatase, mitochondrial 1; protein-tyrosine phosphatase mitochondrial 1; DUSP23; MOSP; PLIP; |
| Gene ID | 114971 |
| mRNA Refseq | NM_001143984 |
| Protein Refseq | NP_001137456 |
| MIM | 609538 |
| Uniprot ID | Q8WUK0 |
| Chromosome Location | 11p11.2 |
| Pathway | 3-phosphoinositide degradation, conserved biosystem; |
| Function | hydrolase activity; phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity; |
| ◆ Recombinant Proteins | ||
| PTPMT1-2547H | Active Recombinant Human PTPMT1 protein(Lys28-Thr201), His-tagged | +Inquiry |
| PTPMT1-3703R | Recombinant Rhesus monkey PTPMT1 Protein, His-tagged | +Inquiry |
| PTPMT1-31117TH | Recombinant Human PTPMT1, His-tagged | +Inquiry |
| PTPMT1-5044Z | Recombinant Zebrafish PTPMT1 | +Inquiry |
| PTPMT1-5223C | Recombinant Chicken PTPMT1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTPMT1-1436HCL | Recombinant Human PTPMT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPMT1 Products
Required fields are marked with *
My Review for All PTPMT1 Products
Required fields are marked with *
