Recombinant Human PUM2, His-tagged PUM2-31265TH

Recombinant Human PUM2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human PUM2, His-tagged

Recombinant Human PUM2, His-tagged

PUM2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PUM2-31265TH
Product Overview : Recombinant fragment, corresponding to amino acids 887-1064 of Human Pumilio 2 with N terminal His tag; MWt 21kDa.
Description : Pumilio homolog 2 is a protein that in humans is encoded by the PUM2 gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 89 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VIQRILEHCTAEQTLPILEELHQHTEQLVQDQYGNYVIQH VLEHGRPEDKSKIVSEIRGKVLALSQHKFASNVVEKCV THASRAERALLIDEVCCQNDGPHSALYTMMKDQYANYV VQKMIDMAEPAQRKIIMHKIRPHITTLRKYTYGKHILA KLEKYYLKNSPDLGPIGGPPNGML
Gene Name : PUM2 pumilio homolog 2 (Drosophila) [ Homo sapiens ]
Official Symbol : PUM2
Synonyms : PUM2; pumilio homolog 2 (Drosophila); pumilio (Drosphila) homolog 2; pumilio homolog 2; KIAA0235; PUMH2;
Gene ID : 23369
mRNA Refseq : NM_015317
Protein Refseq : NP_056132
MIM : 607205
Uniprot ID : Q8TB72
Chromosome Location : 2p22-p21
Function : RNA binding; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy