"PUM2" Related Products

Expand

Recombinant Human PUM2, His-tagged

Cat.No.: PUM2-31265TH
Product Overview: Recombinant fragment, corresponding to amino acids 887-1064 of Human Pumilio 2 with N terminal His tag; MWt 21kDa.
Description: Pumilio homolog 2 is a protein that in humans is encoded by the PUM2 gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 89 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VIQRILEHCTAEQTLPILEELHQHTEQLVQDQYGNYVIQH VLEHGRPEDKSKIVSEIRGKVLALSQHKFASNVVEKCV THASRAERALLIDEVCCQNDGPHSALYTMMKDQYANYV VQKMIDMAEPAQRKIIMHKIRPHITTLRKYTYGKHILA KLEKYYLKNSPDLGPIGGPPNGML
Gene Name: PUM2 pumilio homolog 2 (Drosophila) [ Homo sapiens ]
Official Symbol: PUM2
Synonyms: PUM2; pumilio homolog 2 (Drosophila); pumilio (Drosphila) homolog 2; pumilio homolog 2; KIAA0235; PUMH2;
Gene ID: 23369
mRNA Refseq: NM_015317
Protein Refseq: NP_056132
MIM: 607205
Uniprot ID: Q8TB72
Chromosome Location: 2p22-p21
Function: RNA binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.