Recombinant Human PUM2, His-tagged
Cat.No. : | PUM2-31265TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 887-1064 of Human Pumilio 2 with N terminal His tag; MWt 21kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 887-1064 a.a. |
Description : | Pumilio homolog 2 is a protein that in humans is encoded by the PUM2 gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 89 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VIQRILEHCTAEQTLPILEELHQHTEQLVQDQYGNYVIQH VLEHGRPEDKSKIVSEIRGKVLALSQHKFASNVVEKCV THASRAERALLIDEVCCQNDGPHSALYTMMKDQYANYV VQKMIDMAEPAQRKIIMHKIRPHITTLRKYTYGKHILA KLEKYYLKNSPDLGPIGGPPNGML |
Gene Name | PUM2 pumilio homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | PUM2 |
Synonyms | PUM2; pumilio homolog 2 (Drosophila); pumilio (Drosphila) homolog 2; pumilio homolog 2; KIAA0235; PUMH2; |
Gene ID | 23369 |
mRNA Refseq | NM_015317 |
Protein Refseq | NP_056132 |
MIM | 607205 |
Uniprot ID | Q8TB72 |
Chromosome Location | 2p22-p21 |
Function | RNA binding; protein binding; |
◆ Recombinant Proteins | ||
PUM2-2070H | Recombinant Human PUM2, GST-tagged | +Inquiry |
PUM2-1810H | Recombinant Human PUM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PUM2-5924Z | Recombinant Zebrafish PUM2 | +Inquiry |
PUM2-31265TH | Recombinant Human PUM2, His-tagged | +Inquiry |
PUM2-2867H | Recombinant Human PUM2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PUM2 Products
Required fields are marked with *
My Review for All PUM2 Products
Required fields are marked with *