Recombinant Human PUM2, His-tagged
| Cat.No. : | PUM2-31265TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 887-1064 of Human Pumilio 2 with N terminal His tag; MWt 21kDa. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 887-1064 a.a. | 
| Description : | Pumilio homolog 2 is a protein that in humans is encoded by the PUM2 gene. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitute with 89 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | VIQRILEHCTAEQTLPILEELHQHTEQLVQDQYGNYVIQH VLEHGRPEDKSKIVSEIRGKVLALSQHKFASNVVEKCV THASRAERALLIDEVCCQNDGPHSALYTMMKDQYANYV VQKMIDMAEPAQRKIIMHKIRPHITTLRKYTYGKHILA KLEKYYLKNSPDLGPIGGPPNGML | 
| Gene Name | PUM2 pumilio homolog 2 (Drosophila) [ Homo sapiens ] | 
| Official Symbol | PUM2 | 
| Synonyms | PUM2; pumilio homolog 2 (Drosophila); pumilio (Drosphila) homolog 2; pumilio homolog 2; KIAA0235; PUMH2; | 
| Gene ID | 23369 | 
| mRNA Refseq | NM_015317 | 
| Protein Refseq | NP_056132 | 
| MIM | 607205 | 
| Uniprot ID | Q8TB72 | 
| Chromosome Location | 2p22-p21 | 
| Function | RNA binding; protein binding; | 
| ◆ Recombinant Proteins | ||
| Pum2-5258M | Recombinant Mouse Pum2 Protein, Myc/DDK-tagged | +Inquiry | 
| PUM2-1810H | Recombinant Human PUM2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| PUM2-3122H | Recombinant Human PUM2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| PUM2-983HFL | Recombinant Full Length Human PUM2 Protein, C-Flag-tagged | +Inquiry | 
| PUM2-2867H | Recombinant Human PUM2 protein, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All PUM2 Products
Required fields are marked with *
My Review for All PUM2 Products
Required fields are marked with *
  
        
    
      
            