"PURA" Related Products

Expand
Expand

Recombinant Human PURA

Cat.No.: PURA-31263TH
Product Overview: Recombinant fragment of Human PURA with N terminal proprietary tag, 31.24kDa inclusive of tag.
Description: This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of eukaryotes from yeasts through humans. Thus, it is implicated in the control of both DNA replication and transcription. Deletion of this gene has been associated with myelodysplastic syndrome and acute myelogenous leukemia.
Protein length: 51 amino acids
Molecular Weight: 31.240kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRA
Sequence Similarities: Belongs to the PUR DNA-binding protein family.
Gene Name: PURA purine-rich element binding protein A [ Homo sapiens ]
Official Symbol: PURA
Synonyms: PURA; purine-rich element binding protein A; transcriptional activator protein Pur-alpha; PUR ALPHA; PUR1; PURALPHA;
Gene ID: 5813
mRNA Refseq: NM_005859
Protein Refseq: NP_005850
MIM: 600473
Uniprot ID: Q00577
Chromosome Location: 5q31
Pathway: Diurnally regulated genes with circadian orthologs, organism-specific biosystem;
Function: DNA binding; SMAD binding; double-stranded telomeric DNA binding; protein binding; purine-rich negative regulatory element binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.