"RAB35" Related Products

Expand

Recombinant Human RAB35, His-tagged

Cat.No.: RAB35-29052TH
Product Overview: Recombinant full length Human RAB35 with an N terminal His tag; 221 amino acids with tag, Predicted MWt 25.2 kDa.
Protein length: 201 amino acids
Conjugation: HIS
Molecular Weight: 25.200kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC
Sequence Similarities: Belongs to the small GTPase superfamily. Rab family.
Gene Name: RAB35 RAB35, member RAS oncogene family [ Homo sapiens ]
Official Symbol: RAB35
Synonyms: RAB35; RAB35, member RAS oncogene family; ras-related protein Rab-35; H ray;
Gene ID: 11021
mRNA Refseq: NM_001167606
Protein Refseq: NP_001161078
MIM: 604199
Uniprot ID: Q15286
Chromosome Location: 12q24
Function: GTP binding; GTPase activity; nucleotide binding; phosphatidylinositol-4,5-bisphosphate binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.