"RAP2B" Related Products

Expand
Expand

Recombinant Human RAP2B

Cat.No.: RAP2B-30505TH
Product Overview: Recombinant Full Length Human RAP2B expressed in Saccharomyces cerevisiae; amino acids 1-183; 183 amino acids, 20.5kDa.
Description: This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFY RKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFIL VYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDL EGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEI VRQMNYAAQPNGDEGCCSACVIL
Gene Name: RAP2B RAP2B, member of RAS oncogene family [ Homo sapiens ]
Official Symbol: RAP2B
Synonyms: RAP2B; RAP2B, member of RAS oncogene family; ras-related protein Rap-2b; Ras family small GTP binding protein RAP2B; Ras related protein RAP 2B; small GTP binding protein;
Gene ID: 5912
mRNA Refseq: NM_002886
Protein Refseq: NP_002877
MIM: 179541
Uniprot ID: P61225
Chromosome Location: 3q25.2
Function: GTP binding; GTPase activity; nucleotide binding; protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.