"RING1" Related Products

Expand
Expand

Recombinant Human RING1

Cat.No.: RING1-29982TH
Product Overview: Recombinant full length Human RING1, isoform 2 with proprietary tag, 64.47kDa.
Description: This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4.
Protein length: 377 amino acids
Molecular Weight: 67.470kDa inclusive of tags
Source: Wheat germ
Biological activity: useful for Antibody Production and Protein Array
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK
Sequence Similarities: Contains 1 RING-type zinc finger.
Gene Name: RING1 ring finger protein 1 [ Homo sapiens ]
Official Symbol: RING1
Synonyms: RING1; ring finger protein 1; E3 ubiquitin-protein ligase RING1; RNF1;
Gene ID: 6015
mRNA Refseq: NM_002931
Protein Refseq: NP_002922
MIM: 602045
Uniprot ID: Q06587
Chromosome Location: 6p21.3
Pathway: Delta-Notch Signaling Pathway, organism-specific biosystem;
Function: chromatin binding; ligase activity; metal ion binding; protein binding; ubiquitin-protein ligase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.