"RNPEP" Related Products

Expand
Expand

Recombinant Human RNPEP

Cat.No.: RNPEP-30435TH
Product Overview: Recombinant fragment Human RNPEP with N-terminal proprietary tag. Predicted MW 36.63kDa.
Description: Aminopeptidase B is an enzyme that in humans is encoded by the RNPEP gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS
Sequence Similarities: Belongs to the peptidase M1 family.
Gene Name: RNPEP arginyl aminopeptidase (aminopeptidase B) [ Homo sapiens ]
Official Symbol: RNPEP
Synonyms: RNPEP; arginyl aminopeptidase (aminopeptidase B); aminopeptidase B;
Gene ID: 6051
mRNA Refseq: NM_020216
Protein Refseq: NP_064601
MIM: 602675
Uniprot ID: Q9H4A4
Chromosome Location: 1q32
Function: aminopeptidase activity; aminopeptidase activity; cobalt ion binding; copper ion binding; epoxide hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.