Recombinant Human RNPEP

Cat.No. : RNPEP-30435TH
Product Overview : Recombinant fragment Human RNPEP with N-terminal proprietary tag. Predicted MW 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Aminopeptidase B is an enzyme that in humans is encoded by the RNPEP gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS
Sequence Similarities : Belongs to the peptidase M1 family.
Gene Name RNPEP arginyl aminopeptidase (aminopeptidase B) [ Homo sapiens ]
Official Symbol RNPEP
Synonyms RNPEP; arginyl aminopeptidase (aminopeptidase B); aminopeptidase B;
Gene ID 6051
mRNA Refseq NM_020216
Protein Refseq NP_064601
MIM 602675
Uniprot ID Q9H4A4
Chromosome Location 1q32
Function aminopeptidase activity; aminopeptidase activity; cobalt ion binding; copper ion binding; epoxide hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNPEP Products

Required fields are marked with *

My Review for All RNPEP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon