Recombinant Human RNPEP

• Cat.No.: RNPEP-30435TH
• Product Overview: Recombinant fragment Human RNPEP with N-terminal proprietary tag. Predicted MW 36.63kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Aminopeptidase B is an enzyme that in humans is encoded by the RNPEP gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS
• Sequence Similarities: Belongs to the peptidase M1 family.

Gene Information

• Gene Name: RNPEP arginyl aminopeptidase (aminopeptidase B) [ Homo sapiens ]
• Official Symbol: RNPEP
• Synonyms: RNPEP; arginyl aminopeptidase (aminopeptidase B); aminopeptidase B
• Gene ID: 6051
• mRNA Refseq: NM_020216
• Protein Refseq: NP_064601
• MIM: 602675
• Uniprot ID: Q9H4A4
• Chromosome Location: 1q32
• Function: aminopeptidase activity; aminopeptidase activity; cobalt ion binding; copper ion binding; epoxide hydrolase activity