"RUNX2" Related Products

Expand

Recombinant Human RUNX2

Cat.No.: RUNX2-30473TH
Product Overview: Recombinant fragment corresponding to amino acids 251-350 of Human RUNX2 with a proprietary tag at N-terminal; predicted MWT 36.63kDa inclusive of tag.
Description: This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Specifically expressed in osteoblasts.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Sequence Similarities: Contains 1 Runt domain.
Gene Name: RUNX2 runt-related transcription factor 2 [ Homo sapiens ]
Official Symbol: RUNX2
Synonyms: RUNX2; runt-related transcription factor 2; CBFA1, CCD, CCD1; AML3; PEBP2A1; PEBP2aA1;
Gene ID: 860
mRNA Refseq: NM_001015051
Protein Refseq: NP_001015051
MIM: 600211
Uniprot ID: Q13950
Chromosome Location: 6p21
Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem;
Function: ATP binding; DNA binding; protein binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.