Recombinant Human SCN9A protein, GST-tagged

• Cat.No.: SCN9A-27560TH
• Product Overview: Recombinant Human SCN9A(269 a.a. - 339 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 269-339 a.a.
• Description: This gene encodes a voltage-gated sodium channel which plays a significant role in nociception signaling. Mutations in this gene have been associated with primary erythermalgia, channelopathy-associated insensitivity to pain, and paroxysmal extreme pain disorder.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 33.55 kDa
• AA Sequence: GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SCN9A sodium channel, voltage-gated, type IX, alpha subunit [ Homo sapiens ]
• Official Symbol: SCN9A
• Synonyms: SCN9A; sodium channel, voltage-gated, type IX, alpha subunit; sodium channel, voltage gated, type IX, alpha polypeptide; sodium channel protein type 9 subunit alpha; ETHA; Nav1.7; NE NA; NENA; PN1; hNE-Na; peripheral sodium channel 1; neuroendocrine sodium channel; sodium channel protein type IX subunit alpha; voltage-gated sodium channel alpha subunit Nav1.7; voltage-gated sodium channel subunit alpha Nav1.7; sodium channel, voltage-gated, type IX, alpha polypeptide; SFNP; FEB3B; NE-NA; GEFSP7
• Gene ID: 6335
• mRNA Refseq: NM_002977
• Protein Refseq: NP_002968
• MIM: 603415
• UniProt ID: Q15858
• Chromosome Location: 2q24
• Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Interaction between L1 and Ankyrins, organism-specific biosystem; L1CAM interactions, organism-specific biosystem
• Function: voltage-gated ion channel activity; voltage-gated sodium channel activity