Recombinant Human SCN9A protein, GST-tagged
| Cat.No. : | SCN9A-27560TH |
| Product Overview : | Recombinant Human SCN9A(269 a.a. - 339 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
| Availability | September 25, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 269-339 a.a. |
| Description : | This gene encodes a voltage-gated sodium channel which plays a significant role in nociception signaling. Mutations in this gene have been associated with primary erythermalgia, channelopathy-associated insensitivity to pain, and paroxysmal extreme pain disorder. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 33.55 kDa |
| AA Sequence : | GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | SCN9A sodium channel, voltage-gated, type IX, alpha subunit [ Homo sapiens ] |
| Official Symbol | SCN9A |
| Synonyms | SCN9A; sodium channel, voltage-gated, type IX, alpha subunit; sodium channel, voltage gated, type IX, alpha polypeptide; sodium channel protein type 9 subunit alpha; ETHA; Nav1.7; NE NA; NENA; PN1; hNE-Na; peripheral sodium channel 1; neuroendocrine sodium channel; sodium channel protein type IX subunit alpha; voltage-gated sodium channel alpha subunit Nav1.7; voltage-gated sodium channel subunit alpha Nav1.7; sodium channel, voltage-gated, type IX, alpha polypeptide; SFNP; FEB3B; NE-NA; GEFSP7; |
| Gene ID | 6335 |
| mRNA Refseq | NM_002977 |
| Protein Refseq | NP_002968 |
| MIM | 603415 |
| UniProt ID | Q15858 |
| Chromosome Location | 2q24 |
| Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Interaction between L1 and Ankyrins, organism-specific biosystem; L1CAM interactions, organism-specific biosystem; |
| Function | voltage-gated ion channel activity; voltage-gated sodium channel activity; |
| ◆ Recombinant Proteins | ||
| SCN9A-5570C | Recombinant Chicken SCN9A | +Inquiry |
| SCN9A-5270R | Recombinant Rat SCN9A Protein | +Inquiry |
| SCN9A-55H | Recombinant Human SCN9A Protein, GST&His-tagged | +Inquiry |
| SCN9A-27560TH | Recombinant Human SCN9A protein, GST-tagged | +Inquiry |
| SCN9A-54H | Recombinant Human SCN9A Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCN9A Products
Required fields are marked with *
My Review for All SCN9A Products
Required fields are marked with *
