Recombinant Human SCN9A protein, GST-tagged

Cat.No. : SCN9A-27560TH
Product Overview : Recombinant Human SCN9A(269 a.a. - 339 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Availability August 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 269-339 a.a.
Description : This gene encodes a voltage-gated sodium channel which plays a significant role in nociception signaling. Mutations in this gene have been associated with primary erythermalgia, channelopathy-associated insensitivity to pain, and paroxysmal extreme pain disorder.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 33.55 kDa
AA Sequence : GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SCN9A sodium channel, voltage-gated, type IX, alpha subunit [ Homo sapiens ]
Official Symbol SCN9A
Synonyms SCN9A; sodium channel, voltage-gated, type IX, alpha subunit; sodium channel, voltage gated, type IX, alpha polypeptide; sodium channel protein type 9 subunit alpha; ETHA; Nav1.7; NE NA; NENA; PN1; hNE-Na; peripheral sodium channel 1; neuroendocrine sodium channel; sodium channel protein type IX subunit alpha; voltage-gated sodium channel alpha subunit Nav1.7; voltage-gated sodium channel subunit alpha Nav1.7; sodium channel, voltage-gated, type IX, alpha polypeptide; SFNP; FEB3B; NE-NA; GEFSP7;
Gene ID 6335
mRNA Refseq NM_002977
Protein Refseq NP_002968
MIM 603415
UniProt ID Q15858
Chromosome Location 2q24
Pathway Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Interaction between L1 and Ankyrins, organism-specific biosystem; L1CAM interactions, organism-specific biosystem;
Function voltage-gated ion channel activity; voltage-gated sodium channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCN9A Products

Required fields are marked with *

My Review for All SCN9A Products

Required fields are marked with *

0
cart-icon