"SDCCAG8" Related Products

Recombinant Human SDCCAG8, His-tagged

Cat.No.: SDCCAG8-30297TH
Product Overview: Recombinant fragment, corresponding to amino acids 51-380 of Human SDCCAG8 with N terminal His tag; MWt 38 kDa ,
Description: This gene encodes a centrosome associated protein. This protein may be involved in organizing the centrosome during interphase and mitosis. Mutations in this gene are associated with retinal-renal ciliopathy.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 65 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SFSTSVGNEDARTAWPELQQSHAVNQLKDLLRQQADKESE VSPSRRRKMSPLRSLEHEETNMPTMHDLVHTINDQSQY IHHLEAEVKFCKEELSGMKNKIQVVVLENEGLQQQLKS QRQEETLREQTLLDASGNMHNSWITTGEDSGVGETSKR PFSHDNADFGKAASAGEQLELEKLKLTYEEKCEIEESQLK FLRNDLAEYQRTCEDLKEQLKHKEFLLAANTCNRVGGL CLKCAQHEAVLSQTHTNVHMQTIERLVKERDDLMSALV SVRSSLADTQQREASAYEQVKQVLQISEEANFEKTKAL IQCDQLRKELERQAERLEKELA
Gene Name: SDCCAG8 serologically defined colon cancer antigen 8 [ Homo sapiens ]
Official Symbol: SDCCAG8
Synonyms: SDCCAG8; serologically defined colon cancer antigen 8; BBS16; CCCAP; NPHP10; NY CO 8; SLSN7;
Gene ID: 10806
mRNA Refseq: NM_006642
Protein Refseq: NP_006633
MIM: 613524
Uniprot ID: Q86SQ7
Chromosome Location: 1q43
Pathway: Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; Loss of proteins required for interphase microtubule organization??from the centrosome, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.