Recombinant Human SDHB, His-tagged

• Cat.No.: SDHB-31392TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-280 of Human SDHB with N terminal His tag, MWt 35kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-280 a.a.
• Description: Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 96 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIK KFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIK IKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRR IDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIE PYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCST SCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLA KLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMM ATYKEKKASV
• Sequence Similarities: Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.Contains 1 2Fe-2S ferredoxin-type domain.Contains 1 4Fe-4S ferredoxin-type domain.
• Full Length: Full L.

Gene Information

• Gene Name: SDHB succinate dehydrogenase complex, subunit B, iron sulfur (Ip) [ Homo sapiens ]
• Official Symbol: SDHB
• Synonyms: SDHB; succinate dehydrogenase complex, subunit B, iron sulfur (Ip); SDH, SDH1; succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
• Gene ID: 6390
• mRNA Refseq: NM_003000
• Protein Refseq: NP_002991
• MIM: 185470
• Uniprot ID: P21912
• Chromosome Location: 1p36.1-p35
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate =>
• Function: 2 iron, 2 sulfur cluster binding; 3 iron, 4 sulfur cluster binding; 4 iron, 4 sulfur cluster binding; electron carrier activity; metal ion binding