"SFTPB" Related Products

Expand
Expand

Recombinant Human SFTPB

Cat.No.: SFTPB-30333TH
Product Overview: Recombinant full length Human Prosurfactant Protein B with an N-terminal proprietary tag, 67.98kDa.
Description: This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified.
Protein length: 381 amino acids
Molecular Weight: 67.980kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWC QSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILN KMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYF PLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPL PKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQ FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPL VAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMD DSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQA MLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTC QALGVCGTMSSPLQCIHSPDL
Sequence Similarities: Contains 1 saposin A-type domain.Contains 3 saposin B-type domains.
Gene Name: SFTPB surfactant protein B [ Homo sapiens ]
Official Symbol: SFTPB
Synonyms: SFTPB; surfactant protein B; SFTP3, surfactant, pulmonary associated protein B; pulmonary surfactant-associated protein B; SP B;
Gene ID: 6439
mRNA Refseq: NM_000542
Protein Refseq: NP_000533
MIM: 178640
Uniprot ID: P07988
Chromosome Location: 2p12-p11.2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.