"SI" Related Products

Recombinant Human SI

Cat.No.: SI-29814TH
Product Overview: Recombinant fragment of Human SI with N terminal proprietary tag, predicted mwt: 36.52 kDa.
Description: This gene encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in the poorly differentiated crypt cells of the small intestine as well as in the mature villous cells. Expressed at very low levels in the colon.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DGESIDTYERDLYLSVQFNLNQTTLTSTILKRGYINKSETRLGSLHVWGKGTTPVNAVTLTYNGNKNSLPFNEDTTNMILRIDLTTHNVTLEEPIEINW
Sequence Similarities: Belongs to the glycosyl hydrolase 31 family.Contains 2 P-type (trefoil) domains.
Gene Name: SI sucrase-isomaltase (alpha-glucosidase) [ Homo sapiens ]
Official Symbol: SI
Synonyms: SI; sucrase-isomaltase (alpha-glucosidase); sucrase isomaltase; sucrase-isomaltase, intestinal; Oligosaccharide alpha 1; 6 glucosidase;
Gene ID: 6476
mRNA Refseq: NM_001041
Protein Refseq: NP_001032
MIM: 609845
Uniprot ID: P14410
Chromosome Location: 3q25.2-q26.2
Pathway: Carbohydrate digestion and absorption, organism-specific biosystem; Carbohydrate digestion and absorption, conserved biosystem; Digestion of dietary carbohydrate, organism-specific biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem;
Function: alpha-glucosidase activity; carbohydrate binding; oligo-1,6-glucosidase activity; sucrose alpha-glucosidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.