"SIT1" Related Products

Recombinant Human SIT1, His-tagged

Cat.No.: SIT1-30868TH
Product Overview: Recombinant fragment, of Human SIT with N terminal His tag; 156 amino acids, 16.9 kDa inclusive of tag.
Description: Signaling threshold-regulating transmembrane adapter 1 is a protein that in humans is encoded by the SIT1 gene.
Protein length: 135 amino acids
Conjugation: HIS
Molecular Weight: 16.900kDa inclusive of tags
Source: E. coli
Tissue specificity: Specifically expressed in T- and B-cells. Present in plasma cells but not in germinal center B-cells (at protein level). Expressed in T- and B-cell lymphoma.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMHLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS
Gene Name: SIT1 signaling threshold regulating transmembrane adaptor 1 [ Homo sapiens ]
Official Symbol: SIT1
Synonyms: SIT1; signaling threshold regulating transmembrane adaptor 1; suppression inducing transmembrane adaptor 1; signaling threshold-regulating transmembrane adapter 1; SHP2 interacting transmembrane adaptor; SIT;
Gene ID: 27240
mRNA Refseq: NM_014450
Protein Refseq: NP_055265
MIM: 604964
Uniprot ID: Q9Y3P8
Chromosome Location: 9p13-p12
Pathway: T Cell Receptor Signaling Pathway, organism-specific biosystem;
Function: SH2 domain binding; kinase binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.