Recombinant Human SIT1, His-tagged
Cat.No. : | SIT1-30868TH |
Product Overview : | Recombinant fragment, of Human SIT with N terminal His tag; 156 amino acids, 16.9 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 135 amino acids |
Description : | Signaling threshold-regulating transmembrane adapter 1 is a protein that in humans is encoded by the SIT1 gene. |
Conjugation : | HIS |
Molecular Weight : | 16.900kDa inclusive of tags |
Tissue specificity : | Specifically expressed in T- and B-cells. Present in plasma cells but not in germinal center B-cells (at protein level). Expressed in T- and B-cell lymphoma. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMHLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS |
Gene Name | SIT1 signaling threshold regulating transmembrane adaptor 1 [ Homo sapiens ] |
Official Symbol | SIT1 |
Synonyms | SIT1; signaling threshold regulating transmembrane adaptor 1; suppression inducing transmembrane adaptor 1; signaling threshold-regulating transmembrane adapter 1; SHP2 interacting transmembrane adaptor; SIT; |
Gene ID | 27240 |
mRNA Refseq | NM_014450 |
Protein Refseq | NP_055265 |
MIM | 604964 |
Uniprot ID | Q9Y3P8 |
Chromosome Location | 9p13-p12 |
Pathway | T Cell Receptor Signaling Pathway, organism-specific biosystem; |
Function | SH2 domain binding; kinase binding; protein binding; |
◆ Recombinant Proteins | ||
SIT1-6861H | Recombinant Human Signaling Threshold Regulating Transmembrane Adaptor 1, His-tagged | +Inquiry |
SIT1-5811H | Recombinant Human SIT1 Protein (Gln65-Ser196), N-His tagged | +Inquiry |
SIT1-5070R | Recombinant Rat SIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SIT1-4208R | Recombinant Rhesus monkey SIT1 Protein, His-tagged | +Inquiry |
SIT1-4024R | Recombinant Rhesus Macaque SIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIT1-1827HCL | Recombinant Human SIT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIT1 Products
Required fields are marked with *
My Review for All SIT1 Products
Required fields are marked with *
0
Inquiry Basket