Recombinant Human SIT1, His-tagged

• Cat.No.: SIT1-30868TH
• Product Overview: Recombinant fragment, of Human SIT with N terminal His tag; 156 amino acids, 16.9 kDa inclusive of tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 135 amino acids
• Description: Signaling threshold-regulating transmembrane adapter 1 is a protein that in humans is encoded by the SIT1 gene.
• Conjugation: HIS
• Molecular Weight: 16.900kDa inclusive of tags
• Tissue specificity: Specifically expressed in T- and B-cells. Present in plasma cells but not in germinal center B-cells (at protein level). Expressed in T- and B-cell lymphoma.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMHLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS

Gene Information

• Gene Name: SIT1 signaling threshold regulating transmembrane adaptor 1 [ Homo sapiens ]
• Official Symbol: SIT1
• Synonyms: SIT1; signaling threshold regulating transmembrane adaptor 1; suppression inducing transmembrane adaptor 1; signaling threshold-regulating transmembrane adapter 1; SHP2 interacting transmembrane adaptor; SIT
• Gene ID: 27240
• mRNA Refseq: NM_014450
• Protein Refseq: NP_055265
• MIM: 604964
• Uniprot ID: Q9Y3P8
• Chromosome Location: 9p13-p12
• Pathway: T Cell Receptor Signaling Pathway, organism-specific biosystem
• Function: SH2 domain binding; kinase binding; protein binding