"SLC12A1" Related Products

Recombinant Human SLC12A1

Cat.No.: SLC12A1-31410TH
Product Overview: Recombinant fragment of Human SLC12A1 with N-terminal proprietary tag.Mol Wt 35.86 kDa inclusive of tag.
Description: This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henles loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their biological validity in humans has not been experimentally proven.
Protein length: 93 amino acids
Molecular Weight: 35.860kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Kidney specific.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQA
Sequence Similarities: Belongs to the SLC12A transporter family.
Gene Name: SLC12A1 solute carrier family 12 (sodium/potassium/chloride transporters), member 1 [ Homo sapiens ]
Official Symbol: SLC12A1
Synonyms: SLC12A1; solute carrier family 12 (sodium/potassium/chloride transporters), member 1; solute carrier family 12 member 1; NKCC2;
Gene ID: 6557
mRNA Refseq: NM_000338
Protein Refseq: NP_000329
MIM: 600839
Uniprot ID: Q13621
Chromosome Location: 15q15-q21
Pathway: Cation-coupled Chloride cotransporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem;
Function: ion transmembrane transporter activity; sodium:potassium:chloride symporter activity; symporter activity; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.