Recombinant Human SLC12A1
Cat.No. : | SLC12A1-31410TH |
Product Overview : | Recombinant fragment of Human SLC12A1 with N-terminal proprietary tag.Mol Wt 35.86 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 93 amino acids |
Description : | This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henles loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their biological validity in humans has not been experimentally proven. |
Molecular Weight : | 35.860kDa inclusive of tags |
Tissue specificity : | Kidney specific. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQA |
Sequence Similarities : | Belongs to the SLC12A transporter family. |
Gene Name | SLC12A1 solute carrier family 12 (sodium/potassium/chloride transporters), member 1 [ Homo sapiens ] |
Official Symbol | SLC12A1 |
Synonyms | SLC12A1; solute carrier family 12 (sodium/potassium/chloride transporters), member 1; solute carrier family 12 member 1; NKCC2; |
Gene ID | 6557 |
mRNA Refseq | NM_000338 |
Protein Refseq | NP_000329 |
MIM | 600839 |
Uniprot ID | Q13621 |
Chromosome Location | 15q15-q21 |
Pathway | Cation-coupled Chloride cotransporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem; |
Function | ion transmembrane transporter activity; sodium:potassium:chloride symporter activity; symporter activity; transporter activity; |
◆ Recombinant Proteins | ||
SLC12A1-2697H | Recombinant Human SLC12A1, His-tagged | +Inquiry |
SLC12A1-8216M | Recombinant Mouse SLC12A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC12A1-1202H | Recombinant Human SLC12A1 protein, His & T7-tagged | +Inquiry |
SLC12A1-15207M | Recombinant Mouse SLC12A1 Protein | +Inquiry |
SLC12A1-31410TH | Recombinant Human SLC12A1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC12A1 Products
Required fields are marked with *
My Review for All SLC12A1 Products
Required fields are marked with *