"SLC15A1" Related Products

Expand

Recombinant Human SLC15A1

Cat.No.: SLC15A1-30924TH
Product Overview: Recombinant fragment (amino acids 473-572) of Human SLC15A1 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.
Description: This gene encodes an intestinal hydrogen peptide cotransporter that is a member of the solute carrier family 15. The encoded protein is localized to the brush border membrane of the intestinal epithelium and mediates the uptake of di- and tripeptides from the lumen into the enterocytes. This protein plays an important role in the uptake and digestion of dietary proteins. This protein also facilitates the absorption of numerous peptidomimetic drugs.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFE
Sequence Similarities: Belongs to the PTR2/POT transporter (TC 2.A.17) family.
Gene Name: SLC15A1 solute carrier family 15 (oligopeptide transporter), member 1 [ Homo sapiens ]
Official Symbol: SLC15A1
Synonyms: SLC15A1; solute carrier family 15 (oligopeptide transporter), member 1; solute carrier family 15 member 1; bA551M18.1.1 (solute carrier family 15 (oligopeptide transporter) member 1); HPECT1; HPEPT1; PEPT1; peptide transporter HPEPT1; solute carrier famil
Gene ID: 6564
mRNA Refseq: NM_005073
Protein Refseq: NP_005064
MIM: 600544
Uniprot ID: P46059
Chromosome Location: 13q33-q34
Pathway: Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; Proton/oligonucleotide cotransporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function: molecular_function; oligopeptide transporter activity; peptide:hydrogen symporter activity; symporter activity; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.