Recombinant Human SLC15A1

Cat.No. : SLC15A1-30924TH
Product Overview : Recombinant fragment (amino acids 473-572) of Human SLC15A1 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes an intestinal hydrogen peptide cotransporter that is a member of the solute carrier family 15. The encoded protein is localized to the brush border membrane of the intestinal epithelium and mediates the uptake of di- and tripeptides from the lumen into the enterocytes. This protein plays an important role in the uptake and digestion of dietary proteins. This protein also facilitates the absorption of numerous peptidomimetic drugs.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFE
Sequence Similarities : Belongs to the PTR2/POT transporter (TC 2.A.17) family.
Gene Name SLC15A1 solute carrier family 15 (oligopeptide transporter), member 1 [ Homo sapiens ]
Official Symbol SLC15A1
Synonyms SLC15A1; solute carrier family 15 (oligopeptide transporter), member 1; solute carrier family 15 member 1; bA551M18.1.1 (solute carrier family 15 (oligopeptide transporter) member 1); HPECT1; HPEPT1; PEPT1; peptide transporter HPEPT1; solute carrier famil
Gene ID 6564
mRNA Refseq NM_005073
Protein Refseq NP_005064
MIM 600544
Uniprot ID P46059
Chromosome Location 13q33-q34
Pathway Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; Proton/oligonucleotide cotransporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function molecular_function; oligopeptide transporter activity; peptide:hydrogen symporter activity; symporter activity; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC15A1 Products

Required fields are marked with *

My Review for All SLC15A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon