"SLC26A3" Related Products

Expand
Expand

Recombinant Human SLC26A3

Cat.No. : SLC26A3-31415TH
Product Overview : Recombinant fragment of Human SLC26A3 with a N terminal proprietary tag; Predicted MW 36.41 kDa.
Description : The protein encoded by this gene is a transmembrane glycoprotein that transports chloride ions across the cell membrane in exchange for bicarbonate ions. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. The protein is essential for intestinal chloride absorption, and mutations in this gene have been associated with congenital chloride diarrhea.
Protein length : 98 amino acids
Molecular Weight : 36.410kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT
Sequence Similarities : Belongs to the SLC26A/SulP transporter (TC 2.A.53) family.Contains 1 STAS domain.
Gene Name : SLC26A3 solute carrier family 26, member 3 [ Homo sapiens ]
Official Symbol : SLC26A3
Synonyms : SLC26A3; solute carrier family 26, member 3; CLD, congenital chloride diarrhea , DRA; chloride anion exchanger;
Gene ID : 1811
mRNA Refseq : NM_000111
Protein Refseq : NP_000102
MIM : 126650
Uniprot ID : P40879
Chromosome Location : 7q31
Pathway : Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; Multifunctional anion exchangers, organism-specific biosystem; Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem;
Function : anion:anion antiporter activity; antiporter activity; secondary active sulfate transmembrane transporter activity; sequence-specific DNA binding transcription factor activity; transcription cofactor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.