Recombinant Human SLC9A3
Cat.No. : | SLC9A3-31431TH |
Product Overview : | Recombinant fragment corresponding to amino acids 670-779 of Human Sodium / Hydrogen Exchanger 3 with an N terminal proprietary tag; Predicted MWt 37.84 kDa. |
- Specification
- Gene Information
- Related Products
Protein length : | 110 amino acids |
Molecular Weight : | 37.840kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFT IKEKDLELSDTEEPPNYDEEMSGGIEFLASVTKDTASDSP AGIDNPVFSPDEALDRSLLARLPPWLSPGE |
Sequence Similarities : | Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family. |
Gene Name : | SLC9A3 solute carrier family 9 (sodium/hydrogen exchanger), member 3 [ Homo sapiens ] |
Official Symbol : | SLC9A3 |
Synonyms : | SLC9A3; solute carrier family 9 (sodium/hydrogen exchanger), member 3; NHE3, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3; sodium/hydrogen exchanger 3; |
Gene ID : | 6550 |
mRNA Refseq : | NM_004174 |
Protein Refseq : | NP_004165 |
MIM : | 182307 |
Uniprot ID : | P48764 |
Chromosome Location : | 5p15.3 |
Pathway : | Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Endothelins, organism-specific biosystem; Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; |
Function : | antiporter activity; sodium:hydrogen antiporter activity; solute:hydrogen antiporter activity; |
Products Types
◆ Recombinant Protein | ||
SLC9A3-5245R | Recombinant Rat SLC9A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC9A3-5586R | Recombinant Rat SLC9A3 Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All SLC9A3 Products
Required fields are marked with *
My Review for All SLC9A3 Products
Required fields are marked with *
0
Inquiry Basket