Recombinant Human SLC9A3

Cat.No. : SLC9A3-31431TH
Product Overview : Recombinant fragment corresponding to amino acids 670-779 of Human Sodium / Hydrogen Exchanger 3 with an N terminal proprietary tag; Predicted MWt 37.84 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Molecular Weight : 37.840kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFT IKEKDLELSDTEEPPNYDEEMSGGIEFLASVTKDTASDSP AGIDNPVFSPDEALDRSLLARLPPWLSPGE
Sequence Similarities : Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family.
Gene Name SLC9A3 solute carrier family 9 (sodium/hydrogen exchanger), member 3 [ Homo sapiens ]
Official Symbol SLC9A3
Synonyms SLC9A3; solute carrier family 9 (sodium/hydrogen exchanger), member 3; NHE3, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3; sodium/hydrogen exchanger 3;
Gene ID 6550
mRNA Refseq NM_004174
Protein Refseq NP_004165
MIM 182307
Uniprot ID P48764
Chromosome Location 5p15.3
Pathway Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Endothelins, organism-specific biosystem; Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem;
Function antiporter activity; sodium:hydrogen antiporter activity; solute:hydrogen antiporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC9A3 Products

Required fields are marked with *

My Review for All SLC9A3 Products

Required fields are marked with *

0
cart-icon