Recombinant Human SLC9A3
Cat.No. : | SLC9A3-31431TH |
Product Overview : | Recombinant fragment corresponding to amino acids 670-779 of Human Sodium / Hydrogen Exchanger 3 with an N terminal proprietary tag; Predicted MWt 37.84 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Molecular Weight : | 37.840kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFT IKEKDLELSDTEEPPNYDEEMSGGIEFLASVTKDTASDSP AGIDNPVFSPDEALDRSLLARLPPWLSPGE |
Sequence Similarities : | Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family. |
Gene Name | SLC9A3 solute carrier family 9 (sodium/hydrogen exchanger), member 3 [ Homo sapiens ] |
Official Symbol | SLC9A3 |
Synonyms | SLC9A3; solute carrier family 9 (sodium/hydrogen exchanger), member 3; NHE3, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3; sodium/hydrogen exchanger 3; |
Gene ID | 6550 |
mRNA Refseq | NM_004174 |
Protein Refseq | NP_004165 |
MIM | 182307 |
Uniprot ID | P48764 |
Chromosome Location | 5p15.3 |
Pathway | Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Endothelins, organism-specific biosystem; Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; |
Function | antiporter activity; sodium:hydrogen antiporter activity; solute:hydrogen antiporter activity; |
◆ Recombinant Proteins | ||
SLC9A3-31431TH | Recombinant Human SLC9A3 | +Inquiry |
SLC9A3-5586R | Recombinant Rat SLC9A3 Protein | +Inquiry |
SLC9A3-5245R | Recombinant Rat SLC9A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC9A3 Products
Required fields are marked with *
My Review for All SLC9A3 Products
Required fields are marked with *