Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SLC9A3

Cat.No. : SLC9A3-31431TH
Product Overview : Recombinant fragment corresponding to amino acids 670-779 of Human Sodium / Hydrogen Exchanger 3 with an N terminal proprietary tag; Predicted MWt 37.84 kDa.
  • Specification
  • Gene Information
  • Related Products
Protein length : 110 amino acids
Molecular Weight : 37.840kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFT IKEKDLELSDTEEPPNYDEEMSGGIEFLASVTKDTASDSP AGIDNPVFSPDEALDRSLLARLPPWLSPGE
Sequence Similarities : Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family.
Gene Name : SLC9A3 solute carrier family 9 (sodium/hydrogen exchanger), member 3 [ Homo sapiens ]
Official Symbol : SLC9A3
Synonyms : SLC9A3; solute carrier family 9 (sodium/hydrogen exchanger), member 3; NHE3, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3; sodium/hydrogen exchanger 3;
Gene ID : 6550
mRNA Refseq : NM_004174
Protein Refseq : NP_004165
MIM : 182307
Uniprot ID : P48764
Chromosome Location : 5p15.3
Pathway : Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Endothelins, organism-specific biosystem; Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem;
Function : antiporter activity; sodium:hydrogen antiporter activity; solute:hydrogen antiporter activity;

Products Types

◆ Recombinant Protein
SLC9A3-5245R Recombinant Rat SLC9A3 Protein, His (Fc)-Avi-tagged +Inquiry
SLC9A3-5586R Recombinant Rat SLC9A3 Protein +Inquiry

See All SLC9A3 Recombinant Protein

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends