Recombinant Human SNAPC4
Cat.No. : | SNAPC4-30507TH |
Product Overview : | Recombinant fragment of Human SNAPC4 amino acids with a N terminal proprietary tag; Predicted MWt 37.84 kDa. |
- Specification
- Gene Information
- Related Products
Description : | snRNA-activating protein complex subunit 4 is a protein that in humans is encoded by the SNAPC4 gene. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.840kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMV YQEVIQEKLAEANLLLAQNREQQEELMRDLAGSKGTKVKD GKSLPPSTYMGHFMKPYFKDKVTGVGPPAN |
Sequence Similarities : | Contains 3 HTH myb-type DNA-binding domains.Contains 2 Myb-like domains. |
Gene Name : | SNAPC4 small nuclear RNA activating complex, polypeptide 4, 190kDa [ Homo sapiens ] |
Official Symbol : | SNAPC4 |
Synonyms : | SNAPC4; small nuclear RNA activating complex, polypeptide 4, 190kDa; small nuclear RNA activating complex, polypeptide 4, 190kD; snRNA-activating protein complex subunit 4; FLJ13451; PTFalpha; SNAP190; |
Gene ID : | 6621 |
mRNA Refseq : | NM_003086 |
Protein Refseq : | NP_003077 |
MIM : | 602777 |
Uniprot ID : | Q5SXM2 |
Chromosome Location : | 9q34.3 |
Pathway : | RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; RNA Polymerase III Abortive And Retractive Initiation, organism-specific biosystem; RNA Polymerase III Transcription, organism-specific biosystem; RNA Polymerase III Transcription Initiation, organism-specific biosystem; RNA Polymerase III Transcription Initiation From Type 3 Promoter, organism-specific biosystem; |
Function : | DNA binding; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
SNAPC4-8522M | Recombinant Mouse SNAPC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNAPC4-8232Z | Recombinant Zebrafish SNAPC4 | +Inquiry |
SNAPC4-15671M | Recombinant Mouse SNAPC4 Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All SNAPC4 Products
Required fields are marked with *
My Review for All SNAPC4 Products
Required fields are marked with *
0
Inquiry Basket