Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SNAPC4

Cat.No. : SNAPC4-30507TH
Product Overview : Recombinant fragment of Human SNAPC4 amino acids with a N terminal proprietary tag; Predicted MWt 37.84 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : snRNA-activating protein complex subunit 4 is a protein that in humans is encoded by the SNAPC4 gene.
Protein length : 110 amino acids
Molecular Weight : 37.840kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMV YQEVIQEKLAEANLLLAQNREQQEELMRDLAGSKGTKVKD GKSLPPSTYMGHFMKPYFKDKVTGVGPPAN
Sequence Similarities : Contains 3 HTH myb-type DNA-binding domains.Contains 2 Myb-like domains.
Gene Name : SNAPC4 small nuclear RNA activating complex, polypeptide 4, 190kDa [ Homo sapiens ]
Official Symbol : SNAPC4
Synonyms : SNAPC4; small nuclear RNA activating complex, polypeptide 4, 190kDa; small nuclear RNA activating complex, polypeptide 4, 190kD; snRNA-activating protein complex subunit 4; FLJ13451; PTFalpha; SNAP190;
Gene ID : 6621
mRNA Refseq : NM_003086
Protein Refseq : NP_003077
MIM : 602777
Uniprot ID : Q5SXM2
Chromosome Location : 9q34.3
Pathway : RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; RNA Polymerase III Abortive And Retractive Initiation, organism-specific biosystem; RNA Polymerase III Transcription, organism-specific biosystem; RNA Polymerase III Transcription Initiation, organism-specific biosystem; RNA Polymerase III Transcription Initiation From Type 3 Promoter, organism-specific biosystem;
Function : DNA binding; sequence-specific DNA binding transcription factor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends