Recombinant Human SNAPC4

• Cat.No.: SNAPC4-30507TH
• Product Overview: Recombinant fragment of Human SNAPC4 amino acids with a N terminal proprietary tag; Predicted MWt 37.84 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: snRNA-activating protein complex subunit 4 is a protein that in humans is encoded by the SNAPC4 gene.
• Molecular Weight: 37.840kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMV YQEVIQEKLAEANLLLAQNREQQEELMRDLAGSKGTKVKD GKSLPPSTYMGHFMKPYFKDKVTGVGPPAN
• Sequence Similarities: Contains 3 HTH myb-type DNA-binding domains.Contains 2 Myb-like domains.

Gene Information

• Gene Name: SNAPC4 small nuclear RNA activating complex, polypeptide 4, 190kDa [ Homo sapiens ]
• Official Symbol: SNAPC4
• Synonyms: SNAPC4; small nuclear RNA activating complex, polypeptide 4, 190kDa; small nuclear RNA activating complex, polypeptide 4, 190kD; snRNA-activating protein complex subunit 4; FLJ13451; PTFalpha; SNAP190
• Gene ID: 6621
• mRNA Refseq: NM_003086
• Protein Refseq: NP_003077
• MIM: 602777
• Uniprot ID: Q5SXM2
• Chromosome Location: 9q34.3
• Pathway: RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; RNA Polymerase III Abortive And Retractive Initiation, organism-specific biosystem; RNA Polymerase III Transcription, organism-specific biosystem; RNA Polymerase III Transcription Initiation, organism-specific biosystem; RNA Polymerase III Transcription Initiation From Type 3 Promoter, organism-specific biosystem
• Function: DNA binding; sequence-specific DNA binding transcription factor activity