Recombinant Human SNW1, His-tagged

• Cat.No.: SNW1-29295TH
• Product Overview: Recombinant fragment, corresponding to amino acids 271-536 of Human NCOA62 with an N terminal His tag. Predicted MWt: 32.

Specification

• Description: This gene, a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also function as a splicing factor by interacting with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 57 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVER KMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGE ARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENR DISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAG GEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLE ARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLD KFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE

Gene Information

• Gene Name: SNW1 SNW domain containing 1 [ Homo sapiens ]
• Official Symbol: SNW1
• Synonyms: SNW1; SNW domain containing 1; SKI interacting protein , SKIIP; SNW domain-containing protein 1; Bx42; NCoA 62; Prp45; PRPF45; SKIP
• Gene ID: 22938
• mRNA Refseq: NM_012245
• Protein Refseq: NP_036377
• MIM: 603055
• Uniprot ID: Q13573
• Chromosome Location: 14q22.1-q22.3
• Pathway: Delta-Notch Signaling Pathway, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; NICD traffics to nucleus, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem
• Function: Notch binding; protein binding