Recombinant Human SNW1, His-tagged
Cat.No. : | SNW1-29295TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 271-536 of Human NCOA62 with an N terminal His tag. Predicted MWt: 32. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 271-536 a.a. |
Description : | This gene, a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also function as a splicing factor by interacting with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 57 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVER KMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGE ARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENR DISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAG GEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLE ARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLD KFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE |
Gene Name | SNW1 SNW domain containing 1 [ Homo sapiens ] |
Official Symbol | SNW1 |
Synonyms | SNW1; SNW domain containing 1; SKI interacting protein , SKIIP; SNW domain-containing protein 1; Bx42; NCoA 62; Prp45; PRPF45; SKIP; |
Gene ID | 22938 |
mRNA Refseq | NM_012245 |
Protein Refseq | NP_036377 |
MIM | 603055 |
Uniprot ID | Q13573 |
Chromosome Location | 14q22.1-q22.3 |
Pathway | Delta-Notch Signaling Pathway, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; NICD traffics to nucleus, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; |
Function | Notch binding; protein binding; |
◆ Recombinant Proteins | ||
SNW1-29295TH | Recombinant Human SNW1, His-tagged | +Inquiry |
SNW1-852Z | Recombinant Zebrafish SNW1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNW1-618HCL | Recombinant Human SNW1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNW1 Products
Required fields are marked with *
My Review for All SNW1 Products
Required fields are marked with *
0
Inquiry Basket