Recombinant Human SNW1, His-tagged

Cat.No. : SNW1-29295TH
Product Overview : Recombinant fragment, corresponding to amino acids 271-536 of Human NCOA62 with an N terminal His tag. Predicted MWt: 32.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 271-536 a.a.
Description : This gene, a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also function as a splicing factor by interacting with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 57 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVER KMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGE ARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENR DISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAG GEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLE ARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLD KFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE
Gene Name SNW1 SNW domain containing 1 [ Homo sapiens ]
Official Symbol SNW1
Synonyms SNW1; SNW domain containing 1; SKI interacting protein , SKIIP; SNW domain-containing protein 1; Bx42; NCoA 62; Prp45; PRPF45; SKIP;
Gene ID 22938
mRNA Refseq NM_012245
Protein Refseq NP_036377
MIM 603055
Uniprot ID Q13573
Chromosome Location 14q22.1-q22.3
Pathway Delta-Notch Signaling Pathway, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; NICD traffics to nucleus, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem;
Function Notch binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNW1 Products

Required fields are marked with *

My Review for All SNW1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon