Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SNW1, His-tagged

Cat.No. : SNW1-29295TH
Product Overview : Recombinant fragment, corresponding to amino acids 271-536 of Human NCOA62 with an N terminal His tag. Predicted MWt: 32.
  • Specification
  • Gene Information
  • Related Products
Description : This gene, a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also function as a splicing factor by interacting with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 57 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVER KMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGE ARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENR DISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAG GEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLE ARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLD KFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE
Gene Name : SNW1 SNW domain containing 1 [ Homo sapiens ]
Official Symbol : SNW1
Synonyms : SNW1; SNW domain containing 1; SKI interacting protein , SKIIP; SNW domain-containing protein 1; Bx42; NCoA 62; Prp45; PRPF45; SKIP;
Gene ID : 22938
mRNA Refseq : NM_012245
Protein Refseq : NP_036377
MIM : 603055
Uniprot ID : Q13573
Chromosome Location : 14q22.1-q22.3
Pathway : Delta-Notch Signaling Pathway, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; NICD traffics to nucleus, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem;
Function : Notch binding; protein binding;

Products Types

◆ Recombinant Protein
SNW1-852Z Recombinant Zebrafish SNW1 +Inquiry

See All SNW1 Recombinant Protein

◆ Lysates
SNW1-618HCL Recombinant Human SNW1 lysate +Inquiry

See All SNW1 Lysates

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends