"SOD2" Related Products

Expand
Expand

Recombinant Human SOD2, His-tagged

Cat.No.: SOD2-30343TH
Product Overview: Recombinant full length Human Superoxide Dismutase 2 with His tag; 219 amino acids with tag, MWt 24.4 kDa.
Description: This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Conjugation: HIS
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMKHSLPDLPYDYGALEPHIN AQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIA LQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKR DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAA CPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKA IWNVINWENVTERYMACKK
Sequence Similarities: Belongs to the iron/manganese superoxide dismutase family.
Gene Name: SOD2 superoxide dismutase 2, mitochondrial [ Homo sapiens ]
Official Symbol: SOD2
Synonyms: SOD2; superoxide dismutase 2, mitochondrial; superoxide dismutase [Mn], mitochondrial;
Gene ID: 6648
mRNA Refseq: NM_000636
Protein Refseq: NP_000627
MIM: 147460
Uniprot ID: P04179
Chromosome Location: 6q25
Pathway: FoxO family signaling, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Oxidative Stress, organism-specific biosystem; Peroxisome, organism-specific biosystem;
Function: DNA binding; identical protein binding; manganese ion binding; manganese ion binding; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.