Active Recombinant Human SPARC Protein, Tag Free

• Cat.No.: SPARC-31437TH
• Product Overview: Recombinant Human SPARC ; 286 amino acids, Predicted MWt 33 kDa.

Specification

• Species: Human
• Source: CHO
• Tag: Non
• Protein Length: 18-303 a.a.
• Description: Secreted protein acidic and rich in cysteine/osteonectin/BM40, or SPARC, is a matrix-associated protein that elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (ECM) (Bradshaw et al.
• Molecular Weight: 33.000kDa
• Biological activity: Determined by its ability to increase alkaline phosphatase activity in differentiating MC3T3 cells using a concentration of 0.5-0.7 μg/ml.
• Form: Lyophilised:Reconstitute in waterto a concentration of 0.1-1.0 mg/ml
• Purity: by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10mM Sodium phosphate, pH 7.6
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
• Sequence Similarities: Belongs to the SPARC family.Contains 1 EF-hand domain.Contains 1 follistatin-like domain.Contains 1 Kazal-like domain.

Gene Information

• Gene Name: SPARC secreted protein, acidic, cysteine-rich (osteonectin) [ Homo sapiens ]
• Official Symbol: SPARC
• Synonyms: SPARC; secreted protein, acidic, cysteine-rich (osteonectin); ON; cysteine rich protein; osteonectin
• Gene ID: 6678
• mRNA Refseq: NM_003118
• Protein Refseq: NP_003109
• MIM: 182120
• Uniprot ID: P09486
• Chromosome Location: 5q31-q33
• Pathway: Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Response to elevated platelet cytosolic Ca2+, organism-specific biosystem; Senescence and Autophagy, organism-specific biosystem
• Function: calcium ion binding; collagen binding; extracellular matrix binding; protein binding