"SRPR" Related Products

Expand

Recombinant Human SRPR, His-tagged

Cat.No.: SRPR-29990TH
Product Overview: Recombinant fragment, corresponding to amino acids 194-638 of Human SRPR alpha with N terminal His tag; 445 amino acids, 56kDa.
Description: The gene encodes a subunit of the endoplasmic reticulum signal recognition particle receptor that, in conjunction with the signal recognition particle, is involved in the targeting and translocation of signal sequence tagged secretory and membrane proteins across the endoplasmic reticulum. Alternative splicing results in multiple transcript variants.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 86 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LPVGPENGVELSKEELIRRKREEFIQKHGRGMEKSNKSTK SDAPKEKGKKAPRVWELGGCANKEVLDYSTPTTNGTPE AALSEDINLIRGTGSGGQLQDLDCSSSDDEGAAQNSTK PSATKGTLGGMFGMLKGLVGSKSLSREDMESVLDKMRD HLIAKNVAADIAVQLCESVANKLEGKVMGTFSTVTSTVKQ ALQESLVQILQPQRRVDMLRDIMDAQRRQRPYVVTFCG VNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAGAVE QLRTHTRRLSALHPPEKHGGRTMVQLFEKGYGKDAAGI AMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLITV NTPDLVLFVGEALVGNEAVDQLVKFNRALADHSMAQTP RLIDGIVLTKFDTIDDKVGAAISMTYITSKPIVFVGTG QTYCDLRSLNAKAVVAALMKA
Gene Name: SRPR signal recognition particle receptor (docking protein) [ Homo sapiens ]
Official Symbol: SRPR
Synonyms: SRPR; signal recognition particle receptor (docking protein); signal recognition particle receptor subunit alpha; Sralpha; SRP alpha;
Gene ID: 6734
mRNA Refseq: NM_003139
Protein Refseq: NP_003130
MIM: 182180
Uniprot ID: P08240
Chromosome Location: 11q24-q25
Pathway: Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; Protein export, organism-specific biosystem; Protein export, conserved biosystem;
Function: GTP binding; GTPase activity; nucleotide binding; receptor activity; signal recognition particle binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.