Recombinant Human SRSF3
Cat.No. : | SRSF3-26854TH |
Product Overview : | Recombinant full length Human SFRS3 with N terminal proprietary tag; Predicted MWt 44.11 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other non-coding, have been found for this gene. |
Protein length : | 164 amino acids |
Molecular Weight : | 44.110kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVW VARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVEL SNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRS NERK |
Sequence Similarities : | Belongs to the splicing factor SR family.Contains 1 RRM (RNA recognition motif) domain. |
Gene Name : | SRSF3 serine/arginine-rich splicing factor 3 [ Homo sapiens ] |
Official Symbol : | SRSF3 |
Synonyms : | SRSF3; serine/arginine-rich splicing factor 3; SFRS3, splicing factor, arginine/serine rich 3; SRp20; |
Gene ID : | 6428 |
mRNA Refseq : | NM_003017 |
Protein Refseq : | NP_003008 |
MIM : | 603364 |
Uniprot ID : | P84103 |
Chromosome Location : | 6p21 |
Pathway : | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
Function : | RNA binding; nucleotide binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
SRSF3-26855TH | Recombinant Human SRSF3 | +Inquiry |
SRSF3-4573H | Recombinant Human SRSF3 protein, His-GB1-tagged | +Inquiry |
SRSF3-4142C | Recombinant Chicken SRSF3 | +Inquiry |
◆ Lysates | ||
SRSF3-1904HCL | Recombinant Human SFRS3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket