Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human SRSF3

Cat.No. : SRSF3-26854TH
Product Overview : Recombinant full length Human SFRS3 with N terminal proprietary tag; Predicted MWt 44.11 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other non-coding, have been found for this gene.
Protein length : 164 amino acids
Molecular Weight : 44.110kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVW VARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVEL SNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRS NERK
Sequence Similarities : Belongs to the splicing factor SR family.Contains 1 RRM (RNA recognition motif) domain.
Gene Name : SRSF3 serine/arginine-rich splicing factor 3 [ Homo sapiens ]
Official Symbol : SRSF3
Synonyms : SRSF3; serine/arginine-rich splicing factor 3; SFRS3, splicing factor, arginine/serine rich 3; SRp20;
Gene ID : 6428
mRNA Refseq : NM_003017
Protein Refseq : NP_003008
MIM : 603364
Uniprot ID : P84103
Chromosome Location : 6p21
Pathway : Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function : RNA binding; nucleotide binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends