Recombinant Full Length Human SRSF3 Protein

Cat.No. : SRSF3-497HF
Product Overview : Recombinant full length Human SFRS3 with N terminal proprietary tag; Predicted MWt 44.11 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 164 amino acids
Description : The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other non-coding, have been found for this gene.
Form : Liquid
Molecular Mass : 44.110kDa inclusive of tags
AA Sequence : MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVW VARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVEL SNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRS NERK
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name SRSF3 serine/arginine-rich splicing factor 3 [ Homo sapiens ]
Official Symbol SRSF3
Synonyms SRSF3; serine/arginine-rich splicing factor 3; SFRS3, splicing factor, arginine/serine rich 3; SRp20
Gene ID 6428
mRNA Refseq NM_003017
Protein Refseq NP_003008
MIM 603364
UniProt ID P84103

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRSF3 Products

Required fields are marked with *

My Review for All SRSF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon