"STAG1" Related Products

Recombinant Human STAG1, His-tagged

Cat.No.: STAG1-29260TH
Product Overview: Recombinant fragment, corresponding to amino acids 872-1258 of Human SA1 with N terminal His tag; Predicted MWt 46 kDa.
Description: This gene is a member of the SCC3 family and is expressed in the nucleus. It encodes a component of cohesin, a multisubunit protein complex that provides sister chromatid cohesion along the length of a chromosome from DNA replication through prophase and prometaphase, after which it is dissociated in preparation for segregation during anaphase.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 162 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: FSKLIIYDIVDMHAAADIFKHYMKYYNDYGDIIKETLSKT RQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAHV SGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFK YQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKKTVHSY LEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNS GSSSSKTSSVRNKKGRPPLHKKRVEDESLDNTWLNRTD TMIQTPGPLPAPQLTSTVLRENSRPMGDQIQEPESEHG SEPDFLHNPQMQISWLGQPKLEDLNRKDRTGMNYMKVR TGVRHAVRGLMEEDAEPIFEDVMMSSRSQLEDMNEEFE DTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPM F
Sequence Similarities: Belongs to the SCC3 family.Contains 1 SCD (stromalin conservative) domain.
Gene Name: STAG1 stromal antigen 1 [ Homo sapiens ]
Official Symbol: STAG1
Synonyms: STAG1; stromal antigen 1; cohesin subunit SA-1; SA 1; SCC3A;
Gene ID: 10274
mRNA Refseq: NM_005862
Protein Refseq: NP_005853
MIM: 604358
Uniprot ID: Q8WVM7
Chromosome Location: 3q22.2-q22.3
Pathway: Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; DNA Replication, organism-specific biosystem; M Phase, organism-specific biosystem;
Function: binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.