"STXBP1" Related Products

Expand
Expand
Expand

Recombinant Human STXBP1

Cat.No.: STXBP1-28545TH
Product Overview: Recombinant fragment corresponding to amino acids 74-168 of Human Munc18 with an N terminal proprietary tag; Predicted MWt 36.08 kDa.
Description: This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.
Protein length: 95 amino acids
Molecular Weight: 36.080kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Brain and spinal cord. Highly enriched in axons.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI
Sequence Similarities: Belongs to the STXBP/unc-18/SEC1 family.
Gene Name: STXBP1 syntaxin binding protein 1 [ Homo sapiens ]
Official Symbol: STXBP1
Synonyms: STXBP1; syntaxin binding protein 1; syntaxin-binding protein 1; hUNC18; MUNC18 1; rbSec1; UNC18;
Gene ID: 6812
mRNA Refseq: NM_001032221
Protein Refseq: NP_001027392
MIM: 602926
Uniprot ID: P61764
Chromosome Location: 9q34.1
Pathway: Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem;
Function: SNARE binding; identical protein binding; syntaxin-1 binding; syntaxin-2 binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.