Recombinant Human STXBP1
| Cat.No. : | STXBP1-28545TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 74-168 of Human Munc18 with an N terminal proprietary tag; Predicted MWt 36.08 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 95 amino acids |
| Description : | This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described. |
| Molecular Weight : | 36.080kDa inclusive of tags |
| Tissue specificity : | Brain and spinal cord. Highly enriched in axons. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI |
| Sequence Similarities : | Belongs to the STXBP/unc-18/SEC1 family. |
| Gene Name | STXBP1 syntaxin binding protein 1 [ Homo sapiens ] |
| Official Symbol | STXBP1 |
| Synonyms | STXBP1; syntaxin binding protein 1; syntaxin-binding protein 1; hUNC18; MUNC18 1; rbSec1; UNC18; |
| Gene ID | 6812 |
| mRNA Refseq | NM_001032221 |
| Protein Refseq | NP_001027392 |
| MIM | 602926 |
| Uniprot ID | P61764 |
| Chromosome Location | 9q34.1 |
| Pathway | Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem; |
| Function | SNARE binding; identical protein binding; syntaxin-1 binding; syntaxin-2 binding; |
| ◆ Recombinant Proteins | ||
| STXBP1-16196M | Recombinant Mouse STXBP1 Protein | +Inquiry |
| STXBP1-2987H | Recombinant Human STXBP1 Protein, MYC/DDK-tagged | +Inquiry |
| STXBP1-4582H | Recombinant Human STXBP1 protein | +Inquiry |
| STXBP1-28545TH | Recombinant Human STXBP1 | +Inquiry |
| Stxbp1-6209M | Recombinant Mouse Stxbp1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STXBP1-624HCL | Recombinant Human STXBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STXBP1 Products
Required fields are marked with *
My Review for All STXBP1 Products
Required fields are marked with *
