Recombinant Human STXBP1

• Cat.No.: STXBP1-28545TH
• Product Overview: Recombinant fragment corresponding to amino acids 74-168 of Human Munc18 with an N terminal proprietary tag; Predicted MWt 36.08 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 95 amino acids
• Description: This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.
• Molecular Weight: 36.080kDa inclusive of tags
• Tissue specificity: Brain and spinal cord. Highly enriched in axons.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI
• Sequence Similarities: Belongs to the STXBP/unc-18/SEC1 family.

Gene Information

• Gene Name: STXBP1 syntaxin binding protein 1 [ Homo sapiens ]
• Official Symbol: STXBP1
• Synonyms: STXBP1; syntaxin binding protein 1; syntaxin-binding protein 1; hUNC18; MUNC18 1; rbSec1; UNC18
• Gene ID: 6812
• mRNA Refseq: NM_001032221
• Protein Refseq: NP_001027392
• MIM: 602926
• Uniprot ID: P61764
• Chromosome Location: 9q34.1
• Pathway: Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem
• Function: SNARE binding; identical protein binding; syntaxin-1 binding; syntaxin-2 binding