Recombinant Human STXBP1

Cat.No. : STXBP1-28545TH
Product Overview : Recombinant fragment corresponding to amino acids 74-168 of Human Munc18 with an N terminal proprietary tag; Predicted MWt 36.08 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 95 amino acids
Description : This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.
Molecular Weight : 36.080kDa inclusive of tags
Tissue specificity : Brain and spinal cord. Highly enriched in axons.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI
Sequence Similarities : Belongs to the STXBP/unc-18/SEC1 family.
Gene Name STXBP1 syntaxin binding protein 1 [ Homo sapiens ]
Official Symbol STXBP1
Synonyms STXBP1; syntaxin binding protein 1; syntaxin-binding protein 1; hUNC18; MUNC18 1; rbSec1; UNC18;
Gene ID 6812
mRNA Refseq NM_001032221
Protein Refseq NP_001027392
MIM 602926
Uniprot ID P61764
Chromosome Location 9q34.1
Pathway Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem;
Function SNARE binding; identical protein binding; syntaxin-1 binding; syntaxin-2 binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STXBP1 Products

Required fields are marked with *

My Review for All STXBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon