Recombinant Human STXBP1
Cat.No. : | STXBP1-28545TH |
Product Overview : | Recombinant fragment corresponding to amino acids 74-168 of Human Munc18 with an N terminal proprietary tag; Predicted MWt 36.08 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 95 amino acids |
Description : | This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described. |
Molecular Weight : | 36.080kDa inclusive of tags |
Tissue specificity : | Brain and spinal cord. Highly enriched in axons. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI |
Sequence Similarities : | Belongs to the STXBP/unc-18/SEC1 family. |
Gene Name | STXBP1 syntaxin binding protein 1 [ Homo sapiens ] |
Official Symbol | STXBP1 |
Synonyms | STXBP1; syntaxin binding protein 1; syntaxin-binding protein 1; hUNC18; MUNC18 1; rbSec1; UNC18; |
Gene ID | 6812 |
mRNA Refseq | NM_001032221 |
Protein Refseq | NP_001027392 |
MIM | 602926 |
Uniprot ID | P61764 |
Chromosome Location | 9q34.1 |
Pathway | Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem; |
Function | SNARE binding; identical protein binding; syntaxin-1 binding; syntaxin-2 binding; |
◆ Recombinant Proteins | ||
STXBP1-3034H | Recombinant Human STXBP1, GST-tagged | +Inquiry |
Stxbp1-6209M | Recombinant Mouse Stxbp1 Protein, Myc/DDK-tagged | +Inquiry |
STXBP1-7099C | Recombinant Chicken STXBP1 | +Inquiry |
STXBP1-2135H | Recombinant Human STXBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
STXBP1-3924H | Recombinant Human STXBP1 protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STXBP1-624HCL | Recombinant Human STXBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STXBP1 Products
Required fields are marked with *
My Review for All STXBP1 Products
Required fields are marked with *