"SUMF1" Related Products

Expand

Recombinant Human SUMF1, His-tagged

Cat.No.: SUMF1-30918TH
Product Overview: Recombinant fragment of Human SUMF1 with an N terminal His tag; 304aa, 34.1kDa.
Description: This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants.
Protein length: 284 amino acids
Conjugation: HIS
Molecular Weight: 34.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Ubiquitous. Highly expressed in kidney, pancreas and liver. Detected at lower levels in leukocytes, lung, placenta, small intestine, skeletal muscle and heart.
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.03% DTT, 12.01% Urea
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMVPIPAGVFTMGTDDPQIKQ DGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAE KFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRH PEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAE WEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNT GEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHH SVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARS QNTPDSSASNLGFRCAADRLPTMD
Sequence Similarities: Belongs to the sulfatase-modifying factor family.
Gene Name: SUMF1 sulfatase modifying factor 1 [ Homo sapiens ]
Official Symbol: SUMF1
Synonyms: SUMF1; sulfatase modifying factor 1; sulfatase-modifying factor 1; FGE; UNQ3037;
Gene ID: 285362
mRNA Refseq: NM_182760
Protein Refseq: NP_877437
MIM: 607939
Uniprot ID: Q8NBK3
Chromosome Location: 3p26.1
Pathway: Lysosome, organism-specific biosystem; Lysosome, conserved biosystem;
Function: binding; metal ion binding; oxidoreductase activity; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.