Recombinant Full Length Human SUMF1 Protein, C-Flag-tagged
Cat.No. : | SUMF1-414HFL |
Product Overview : | Recombinant Full Length Human SUMF1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.3 kDa |
AA Sequence : | MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRY SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFV NSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVS WNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAP VDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARS QNTPDSSASNLGFRCAADRLPTMDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SUMF1 sulfatase modifying factor 1 [ Homo sapiens (human) ] |
Official Symbol | SUMF1 |
Synonyms | FGE; UNQ3037; AAPA3037 |
Gene ID | 285362 |
mRNA Refseq | NM_182760.4 |
Protein Refseq | NP_877437.2 |
MIM | 607939 |
UniProt ID | Q8NBK3 |
◆ Recombinant Proteins | ||
SUMF1-2139H | Recombinant Human SUMF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUMF1-8869M | Recombinant Mouse SUMF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUMF1-3767Z | Recombinant Zebrafish SUMF1 | +Inquiry |
SUMF1-5828H | Recombinant Human SUMF1 Protein (Glu113-Ser356), N-His tagged | +Inquiry |
SUMF1-414HFL | Recombinant Full Length Human SUMF1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUMF1-1346HCL | Recombinant Human SUMF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SUMF1 Products
Required fields are marked with *
My Review for All SUMF1 Products
Required fields are marked with *
0
Inquiry Basket