Recombinant Human SUMF1, His-tagged
Cat.No. : | SUMF1-30918TH |
Product Overview : | Recombinant fragment of Human SUMF1 with an N terminal His tag; 304aa, 34.1kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 284 amino acids |
Description : | This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. |
Conjugation : | HIS |
Molecular Weight : | 34.100kDa inclusive of tags |
Tissue specificity : | Ubiquitous. Highly expressed in kidney, pancreas and liver. Detected at lower levels in leukocytes, lung, placenta, small intestine, skeletal muscle and heart. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.03% DTT, 12.01% Urea |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMVPIPAGVFTMGTDDPQIKQ DGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAE KFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRH PEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAE WEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNT GEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHH SVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARS QNTPDSSASNLGFRCAADRLPTMD |
Sequence Similarities : | Belongs to the sulfatase-modifying factor family. |
Gene Name | SUMF1 sulfatase modifying factor 1 [ Homo sapiens ] |
Official Symbol | SUMF1 |
Synonyms | SUMF1; sulfatase modifying factor 1; sulfatase-modifying factor 1; FGE; UNQ3037; |
Gene ID | 285362 |
mRNA Refseq | NM_182760 |
Protein Refseq | NP_877437 |
MIM | 607939 |
Uniprot ID | Q8NBK3 |
Chromosome Location | 3p26.1 |
Pathway | Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; |
Function | binding; metal ion binding; oxidoreductase activity; protein homodimerization activity; |
◆ Recombinant Proteins | ||
SUMF1-30918TH | Recombinant Human SUMF1, His-tagged | +Inquiry |
SUMF1-16236M | Recombinant Mouse SUMF1 Protein | +Inquiry |
SUMF1-5827H | Recombinant Human SUMF1 Protein (Ser34-Asp374), C-His tagged | +Inquiry |
SUMF1-3767Z | Recombinant Zebrafish SUMF1 | +Inquiry |
SUMF1-414HFL | Recombinant Full Length Human SUMF1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUMF1-1346HCL | Recombinant Human SUMF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUMF1 Products
Required fields are marked with *
My Review for All SUMF1 Products
Required fields are marked with *