Recombinant Human SUPT5H, His-tagged

• Cat.No.: SUPT5H-31482TH
• Product Overview: Recombinant fragment, corresponding to amino acids 968-1087 of Human SUPT5H with N terminal His tag; 120 amino acids, 18.3kDa.

Specification

• Description: Transcription elongation factor SPT5 is a protein that in humans is encoded by the SUPT5H gene.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 41 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Store at 4°C. Upon reconstitution store at -80oC.
• Sequences of amino acids: PGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSV TGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVIL GEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLL EA

Gene Information

• Gene Name: SUPT5H suppressor of Ty 5 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SUPT5H
• Synonyms: SUPT5H; suppressor of Ty 5 homolog (S. cerevisiae); suppressor of Ty (S.cerevisiae) 5 homolog; transcription elongation factor SPT5; FLJ34157; SPT5; SPT5H
• Gene ID: 6829
• mRNA Refseq: NM_001111020
• Protein Refseq: NP_001104490
• MIM: 602102
• Uniprot ID: O00267
• Chromosome Location: 19q13
• Pathway: Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem
• Function: enzyme binding; protein binding; protein heterodimerization activity