"SUZ12" Related Products

Recombinant Human SUZ12

Cat.No.: SUZ12-31487TH
Product Overview: Recombinant fragment corresponding to amino acids 640-739 of Human SUZ12 with a propreitary tag at N-terminal; predicted mwt: 36.63 kDa.
Description: This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Overexpressed in breast and colon cancer.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL
Sequence Similarities: Belongs to the VEFS (VRN2-EMF2-FIS2-SU(Z)12) family.Contains 1 C2H2-type zinc finger.
Gene Name: SUZ12 suppressor of zeste 12 homolog (Drosophila) [ Homo sapiens ]
Official Symbol: SUZ12
Synonyms: SUZ12; suppressor of zeste 12 homolog (Drosophila); polycomb protein SUZ12; CHET9; JJAZ1; KIAA0160;
Gene ID: 23512
mRNA Refseq: NM_015355
Protein Refseq: NP_056170
MIM: 606245
Uniprot ID: Q15022
Chromosome Location: 17q21
Function: chromatin binding; histone methyltransferase activity; metal ion binding; methylated histone residue binding; protein binding;
Products Types

◆ Lysates

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.