"SYN2" Related Products

Recombinant Human SYN2

Cat.No.: SYN2-31489TH
Product Overview: Recombinant fragment of Human Synapsin II with N terminal proprietary tag, 36.74kDa.
Description: This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family encodes a neuron-specific phosphoprotein that selectively binds to small synaptic vesicles in the presynaptic nerve terminal. The TIMP4 gene is located within an intron of this gene and is transcribed in the opposite direction. Mutations in this gene may be associated with abnormal presynaptic function and schizophrenia. Alternative splicing of this gene results in two transcripts.
Protein length: 101 amino acids
Molecular Weight: 36.740kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AMSDRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEV MDCSMPLIGEHQVEDRQLITELVISKMNQLLSRTPALSPQ RPLTTQQPQSGTLKDPDSSKT
Gene Name: SYN2 synapsin II [ Homo sapiens ]
Official Symbol: SYN2
Synonyms: SYN2; synapsin II; synapsin-2; SYNII; SYNIIa; SYNIIb;
Gene ID: 6854
mRNA Refseq: NM_133625
Protein Refseq: NP_598328
MIM: 600755
Uniprot ID: Q92777
Chromosome Location: 3
Pathway: Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; Neuronal System, organism-specific biosystem; Neurotransmitter Release Cycle, organism-specific biosystem; Serotonin Neurotransmitter Release Cycle, organism-specific biosystem; Transmission across Chemical Synapses, organism-specific biosystem;
Function: ATP binding; ligase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.